DPCstruct | MC31671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 103 ± 14 aa |
| Standard deviation of domain lengths | 13.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812TQ88 | 1-103 | MAVRVVLLLVLAATGAHANIVEVSVYNSNECPVGSDDLTLEECIYFNNTDPRNGDGRFVEHNESYYPKGCFLMYSAFHWNYHPTGAA… |
| A0A7S2K9J4 | 6-95 | VQWNALMSELGMACPDGTMPIVSSTWACIAALHYVGKDAGIYLGTESEPIFPKGCYEFLFTENLAFVFMNEHETGALESQSRNFCHQ… |
| A0A812SMM6 | 329-446 | None |
| A0A7S0IPW9 | 87-182 | None |
| A0A7S0J4S8 | 4-98 | None |
| A0A7S0A9P9 | 13-131 | None |
| A0A813BIT0 | 262-362 | None |
| A0A7S2JQD0 | 69-163 | None |
| A0A812Y5G8 | 855-961 | None |
| A0A7S0GEB1 | 143-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.