DPCstruct | MC31669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804P6D1 | 8-131 | EPKVDGELIFAYAKIDMLSDIEEFILMPNVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKLFQGAVEAARKANSAKT… |
| A0A812SUM1 | 2-127 | ARTKVKDSQIDGELVYAYAKTERLGEMEEFISGTNTANIQSVGDRLYDEKFYKAAKILYASIPNNGRLASCHVQLGEYTQAVEAAKK… |
| A0A0P0XY45 | 171-291 | None |
| A0A314YZY3 | 222-339 | None |
| Q10161 | 1144-1283 | None |
| A0A816BKA6 | 149-273 | None |
| A0A6A2YH39 | 14-127 | None |
| A0A1I8FH54 | 369-478 | None |
| A0A820LI18 | 92-222 | None |
| A0A1C1CBU5 | 1158-1291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.