DPCstruct | MC31664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 307 ± 19 aa |
| Standard deviation of domain lengths | 18.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 38.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9EL73 | 166-483 | MAYLLDVAILIGDAELARCCAQHCTRWPLRRWRGEELVRIMEDDFPCLRAEIWEKDVLVAALAGGLELEHLNSAAWASVVSLAEAIV… |
| A0A812RT61 | 1-276 | MARLWDLAILTGDAALARRCSQQCRLPLRRWQAQDLFKMLRGQGWCIAAAAPEVLTAAITSGLTFQGLHYTYFGQLLPADCLIPFRE… |
| A0A812YGD7 | 109-432 | None |
| A0A1Q9DAX7 | 167-445 | None |
| A0A813AEZ1 | 1-322 | None |
| A0A812I310 | 122-416 | None |
| A0A7S1AEL0 | 153-486 | None |
| A0A812S2I7 | 193-496 | None |
| A0A813AW72 | 188-505 | None |
| A0A812QWS6 | 183-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.