DPCstruct | MC3166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 110 ± 6 aa |
| Standard deviation of domain lengths | 6.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8XSY7 | 1-107 | MFIKALYVSDLHSYIDKTISQLEQIHTQVKNIQKSIEAIIALEDAFKGKTANSIRAFYQEVHMPFLLFLEGFIMNYSDTLQEMKKSI… |
| A0A150JXK6 | 1-111 | MKTLDVQGFEQAATDTQRALKEKAEQITGLQQAIDSFVNMEDAFKGKAGNAIRGYFRDFHQPFLMYLQSFLARYNGQLNQILKELSA… |
| A0A268AG62 | 6-108 | None |
| A0A5B0DI15 | 10-112 | None |
| A0A7Z2FW01 | 1-111 | None |
| M7NXY8 | 1-121 | None |
| A0A806TTF1 | 1-103 | None |
| A0A7X9MXC5 | 1-104 | None |
| A0A380XF59 | 1-111 | None |
| A0A1R1QPT6 | 1-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.