DPCstruct | MC31659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 9.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 70.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S2JFS6 | 19-113 | RLKQLSDFLQHYKLSQCLDIFVSEGFDRLSSLFDITESDLISLNVKRGHRRLLQRAIATARGVPISTPIVINYGYDEPDISYTPKPG… |
| A0A4Z1KV33 | 1-107 | MDLPDMNPPDREVQLILIRLQMLCYLNRLVEAGFDNWKVVKDITEKDMQILGMKLGHIRKLQREIATSRGWPQNAPLNGPYVCCGGQ… |
| A0A2V1B685 | 2-98 | None |
| A0A163F3L4 | 25-143 | None |
| A0A1L7X387 | 3-111 | None |
| A0A094FR15 | 24-131 | None |
| A0A1Y1XVV4 | 1-115 | None |
| A0A2V1CXH4 | 16-125 | None |
| E4ZG90 | 147-237 | None |
| A0A517L154 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.