DPCstruct | MC31655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0U5D2 | 31-95 | IQEAAQTQYLEKEGEHCPTCGSNDLQGGSVDVDSPHASQPMSCGDCRATWTDQYQLTGFADLKEG |
| A0A1W6KFG3 | 5-72 | ENPTTIEETYLAGEPNLCPCCHSDEVEGDEVVIQGKKAIQEMGCNNCEAEWEDVYTLSAVRSQDFNPD |
| A0A0C2ZGJ2 | 1-70 | None |
| M1PK99 | 1-61 | None |
| A0A1V6CG46 | 7-70 | None |
| A0A6C2TYH3 | 8-61 | None |
| A0A3N8CL32 | 61-122 | None |
| A0A1E3LMM0 | 128-207 | None |
| A0A353QRI1 | 2-67 | None |
| X1AKR3 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.