DPCstruct | MC31654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 15 aa |
| Standard deviation of domain lengths | 14.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2QA58 | 10-147 | YNGNILTLGLGPILSRPDALRALTYLPAPPRQIEKVPKHIRLHHLMGLRDFHIPCLEGLRLQASIDLMIRQSYRYRDPQVPQTWSVL… |
| A0A1W6K4R2 | 1-159 | MIKLPFAQYRQAEICEYEGQPLINALPPINSPQDTAKMLARFPKVDEAEKALPAHIRRHAMMRILDQFLYPTKSHLQLEQMISGMIR… |
| A0A2X1IV28 | 8-163 | None |
| W4R0A0 | 665-843 | None |
| A0A410MXP3 | 1-183 | None |
| A0A5N7MVZ6 | 13-171 | None |
| A0A501VZD7 | 1-152 | None |
| A0A132CAP4 | 2-134 | None |
| A0A813AGW7 | 1-157 | None |
| A0A7W4C3B6 | 7-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.