DPCstruct | MC31645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 128 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6MLX2 | 2-142 | ETGIIIVAACLLLSLAMGIMFQSPPLLAALLISFALGSVYSIELPFLRWKKHAFLAASCILIARAMVVQLAFFVHIQKFVLGKPIVI… |
| A0A4D6NNJ8 | 142-272 | GTGVILTASCLILSFGIGWIAGSPPLLWALSIHFFLGTAYSIDLPLLRWKRIAALAAMCMVVGRGITFQLAYFLHMQTYVFKRPTML… |
| A0A1D6EVT3 | 152-290 | None |
| A0A2I0KM27 | 49-175 | None |
| A0A3Q0EN11 | 22-128 | None |
| A0A453T311 | 10-146 | None |
| A0A4S4EK67 | 2-127 | None |
| A0A835M045 | 158-276 | None |
| A0A2H5PPF4 | 2-117 | None |
| A0A804MQZ1 | 199-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.