DPCstruct | MC31644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6MJW4 | 1-107 | MASTITDKFFFKGTKWEFSLNPGPFNMKEHVLITIFANSGDGNVHAIHIVSAIKIFYKKELTFIVAFLVVITTQVLGFGWAGVFRRY… |
| A0A4D9C3Q9 | 93-206 | AAALTRRVFFPGRRWEFSLNPGRFNVKEHVLITIFANSGAANPYSIHIVSAVKLFYGRKMTFWVSLGVVLTTQILGFGWAGLLRRYL… |
| M0ZW46 | 44-164 | None |
| A0A146IEL9 | 3-106 | None |
| A0A7N0V936 | 12-132 | None |
| A0A7J7E3E4 | 181-287 | None |
| A0A2I0JLB1 | 1-108 | None |
| B9S9X0 | 30-154 | None |
| A0A2I0JKC8 | 87-200 | None |
| A0A6A2XWK8 | 42-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.