DPCstruct | MC31643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 155 ± 32 aa |
| Standard deviation of domain lengths | 31.75 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.46 |
| Pfam Score | 77.69 |
| Assigned Pfam label(s) | PF20985- CL0093 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4FLY9 | 2-96 | AHRSHVDSSVELIGSLLFGSEDGPRVLKAVRAPGEPLVDDWSCLKSIVRTFEARCGSLAQYGMKHMRSFANMCNAGILPEAVSKVAA… |
| A0A6A6MHD6 | 121-273 | FDPASVNFPPKNGHISAPMDVVNQRDAELLFMWQMYKRSKDGSEKKTQILQQVTETIKHRKHLDSSIELIGTLLFGPQKSSSILHSV… |
| A0A0D8Y425 | 171-359 | None |
| A0A843UE73 | 2-123 | None |
| T1KRL7 | 29-223 | None |
| A0A5B6WDJ6 | 29-207 | None |
| A0A2U1QNR3 | 2-153 | None |
| A0A0K9QZ96 | 731-870 | None |
| A0A6P8BTD4 | 101-239 | None |
| A0A0E0HJM6 | 7-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.