DPCstruct | MC31642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L2GIW3 | 13-97 | FLLYYLKSILGYSIKYNKNTIVLKSVYAFSAEDTFEIVVQDNKLLLKDTVYLREWSELVSVYIKNGRSYCAFFAAVTLELYNRKT |
| A0A418BMA1 | 38-148 | ASSSHDSVEGLQKMNQRLKEVFREQIAKYRDAVYQCTGYKVDLKYPELVLRSIYAENEGDEVKFQFNNGELELLETPFVAGLDQRNM… |
| A0A1I8I0A7 | 101-228 | None |
| A0A2A2KNK2 | 187-316 | None |
| A0A0K0DW77 | 401-525 | None |
| A0A7E4VUE5 | 441-566 | None |
| A0A226EUJ7 | 645-770 | None |
| A0A6P8VK46 | 186-310 | None |
| H9GGH9 | 145-264 | None |
| C1ECD9 | 3-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.