DPCstruct | MC31638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7WBK4 | 5-86 | MRFVKSSTAFEGQQAGASLWASTYHGPKLIVFGHDAKAGLQDTPFALGLDTGCCYGKRLTAVILPERRLVSVPAFKTYTSTP |
| A0A7X5WWR3 | 64-126 | SYWHQHYTDAKPVVFGHHVTGREPMIRDGRIFGLDTGACHGWNLTALCVPGFTVHSVKAHGDH |
| A0A3T0K408 | 174-275 | None |
| A0A378BDN9 | 16-125 | None |
| A0A365VPK8 | 2-91 | None |
| A0A3L7UUZ9 | 352-440 | None |
| A0A7S2SKQ0 | 25-115 | None |
| A0A6L5C6G4 | 766-867 | None |
| A0A2T7PD25 | 611-699 | None |
| A0A7S0DIL5 | 85-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.