DPCstruct | MC31637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 124 ± 24 aa |
| Standard deviation of domain lengths | 23.72 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7DJA1 | 27-145 | LPPTTAPEPVCGRGIDLQAEVAYENRMQRYCAVCSFERDLRLIKTQRCSVHQVYLCTKAHVAHIGDQTMVASNLCPHIAWDCWDKFH… |
| A0A6A3P297 | 63-174 | PETSQKDCVAVASEQALKECNRKRRGCVICRWENRYATEKTDYCDNHNVCLCRVVYLGEAMAFVCPDTTLTCWQKFLMFYFPKSLFS… |
| W4FQB9 | 8-172 | None |
| A0A225W2I9 | 1-117 | None |
| A0A225WAM0 | 7-97 | None |
| A0A6A3R188 | 581-705 | None |
| A0A080Z0V3 | 803-923 | None |
| A0A3L6VL76 | 106-270 | None |
| A0A6A5A157 | 1-105 | None |
| A0A3R8DCI2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.