DPCstruct | MC31636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 109 ± 19 aa |
| Standard deviation of domain lengths | 19.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7CAF8 | 8-173 | ADGEMAAATTESEIVGMPQKKFYRSRAHCNPLSHNDSFDYPLNPADMNWSTHFPKLENPYVLHFVIIPDLGCFRKVDILDIGCGFGG… |
| E1ZAU1 | 11-111 | RVRQHVNPLKKELQVPTEPPVWEEVYEQPGRPMVLDLGCGYGRFLLALSKAMPGHNMAGLEIRAPIIERANKWAVNLGLDRSVLFLR… |
| A0A4Q2D9E3 | 3-132 | None |
| A0A835R4B9 | 182-298 | None |
| A0A090KZ72 | 59-161 | None |
| Q5B720 | 941-1037 | None |
| A0A5N6Q124 | 646-768 | None |
| A0A0D8XMS2 | 232-333 | None |
| A0A3R6WMU3 | 12-107 | None |
| A0A4T0Q8M2 | 31-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.