DPCstruct | MC31635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 204 ± 41 aa |
| Standard deviation of domain lengths | 41.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8ZRV6 | 72-257 | PWSRKPDKKITSEEVKYALSNHFQETPYDAYSKRADLKLKNSYRSIGINRTSTLGLVQLRPDLPAECMALEWVTYGCNVFNTLIPFY… |
| A0A3R7BV31 | 649-839 | RDHYENTEFDLTVGVAAGPYGTVDSETALNGRFETPIGGSTYSYVVTLDPTSAFNALLWFAPHAPSASTYIPVFVKATVVPAVIGTG… |
| A0A7J6U1A7 | 5-175 | None |
| A0A7J6TXV6 | 178-397 | None |
| A0A7K3HTI8 | 193-444 | None |
| R1CVU4 | 241-461 | None |
| A0A7S2UW43 | 1-156 | None |
| A0A3D1QXZ6 | 2-171 | None |
| A0A524JY92 | 18-172 | None |
| A0A401FJE2 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.