DPCstruct | MC31634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 4.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0JBU3 | 120-176 | VGGTQRLFAGRATDKSSQLVLRDGQGRKRLVLRVGEDGATSIDFLDQAGKVQRTVRP |
| A0A429BSR9 | 1-64 | MTTLDPRTASPQRVFIGKNPDKSSAVTLADGKGAPRIVMRVDQDGNPQIRFLNAKGKVTRTIKG |
| A0A3A4UAP5 | 2-63 | None |
| A0A127R0E0 | 8-63 | None |
| A0A2V7EQK4 | 12-66 | None |
| A0A7X5QSS8 | 1-51 | None |
| W4RX02 | 71-119 | None |
| W4RSR2 | 33-83 | None |
| A0A1V1PS54 | 33-88 | None |
| A0A3D2KMH4 | 117-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.