DPCstruct | MC31632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 157 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 12.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4LF82 | 21-152 | AAFAADLSTQMMAVQDVQTIDYGDGFTVTITTTLVNKNARSSTTTYSKTAVARYDGTKVGEFTLHGEFSYNGSSAKATNVSSDVEDY… |
| A0A429AGZ3 | 27-186 | SSPADPDTELATTENGEEPLDSISSEDYLAKLAQNDVIVSAEERTQILASSCWIYTGYRGGKNRVGQWLWKYFQRMDYCRDGSRITS… |
| A0A7W0HIX8 | 51-211 | None |
| A0A0S7CZW7 | 91-261 | None |
| A0A2M8YZE1 | 8-157 | None |
| A0A6I5X4S6 | 35-184 | None |
| A0A6G4A304 | 32-201 | None |
| A0A2A2D0X5 | 12-153 | None |
| A0A4U2PT08 | 23-192 | None |
| R6GJ32 | 186-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.