DPCstruct | MC31631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 187 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A239C133 | 943-1126 | RIEACWVNRDGSTAPAITTLSVRPPRSDRDRRAAERLFTAPVGRVLAIGGTRTIDEVNELLGEVAGDLGVQHPASLYLRTARTVPLA… |
| A0A7K3ZUM2 | 324-515 | FDEIGEYQLRAIYHSLDGSLVISDTLSFRVKAPHNSTDEDVADLLLGHEQGTLFYLLGSDSEFLKNGNKAFDTLISDYREHPLAVYA… |
| A0A0J9E7Q4 | 703-894 | None |
| A0A6N7G2J2 | 1-167 | None |
| A0A523JPF8 | 924-1105 | None |
| A0A0M0BVW7 | 479-678 | None |
| A0A5H2U657 | 721-910 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.