DPCstruct | MC3163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 160 ± 11 aa |
| Standard deviation of domain lengths | 11.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2GTW1 | 108-246 | GYRNLARQQYLWDGWNERRPGFKLAAKPGTSIHGLGRAVDFSGGIDSYGTTAKNWMNKNGPTYGWIPKGDGFSPLEPWHFEYDGSWT… |
| A0A2W4XPJ3 | 5-148 | QAGTGNLAAYPGTSNHGWGISCDFGSGVQTAGTAAKRWMDANAPAYGWQPTGNGFSRPEPWHFDYVAAYPGPGNTLLVDSGLVVVRC… |
| T5KPT0 | 19-186 | None |
| A0A3N1MIR8 | 106-264 | None |
| A0A2S3ZQC7 | 1-166 | None |
| A0A2S8ZG40 | 119-265 | None |
| A0A2E0SRH7 | 49-212 | None |
| A0A1Q4A5J9 | 46-206 | None |
| A0A1S7D0V4 | 42-207 | None |
| A0A852XEM1 | 24-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.