DPCstruct | MC31627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 108 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E4YKW5 | 18-116 | ENNTVLNVMPVGFDNRLSRKALIGICGLSDRQVRKAIEDIVESKQAIIINMHKGYFIPNLENKTDRDYYRLFISQEESRINKLNKKM… |
| A0A3M1SC41 | 13-127 | EITEQDVRSVAQILIRHIGEENSIELRDLANMIYGTYNENTERKLRYILEKLVTDYGIPVGARSGKSGRWLCKGRDEIEKVLSDLKA… |
| A0A7T9N5F2 | 5-106 | None |
| M6UMX2 | 6-134 | None |
| A0A1G0SEC4 | 5-105 | None |
| A0A0R1VHG8 | 123-222 | None |
| A0A3A4ZBV2 | 15-119 | None |
| A0A357NGS2 | 60-160 | None |
| C7XW51 | 20-118 | None |
| A0A445MWH9 | 107-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.