DPCstruct | MC31625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 138 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07262 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1Q362 | 19-167 | RWRGRATATVWKLPDRIVISREERTARGIALPVEPTLVVPRGAPQERLGAALRRALAGPERRQPEPRSWDRAHDRLVEAAGVSSHRW… |
| A0A3R8T756 | 21-157 | QKIAWASVLANDRFFCLRTCSGYRASIVDPQGAAIYLEPSACDERLGEAVLTCLAQSRFVAPYAHKRVNPEAGVDAELHDPVRIGDR… |
| A0A1B6VFS6 | 102-256 | None |
| A0A142YCT0 | 19-159 | None |
| A0A511FNE3 | 48-198 | None |
| A0A1M3GA77 | 9-130 | None |
| A0A4R2CK98 | 262-406 | None |
| A0A7X0H3S7 | 9-151 | None |
| A0A2R5EQC7 | 3-124 | None |
| A0A1L9QPE2 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.