DPCstruct | MC31617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 153 ± 13 aa |
| Standard deviation of domain lengths | 12.51 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.79 |
| Pfam Score | 95.00 |
| Assigned Pfam label(s) | PF02769- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379VM81 | 44-202 | GFSVSNLRIPGFEQPWEEDFGKPERIVTALDIMTEGPLGGAAFNNEFGRPALTGYFRTYEEKVNSHNGEELRGYHKPIMLAGGIGNI… |
| A0A7E4RDR1 | 169-322 | VVDVMSKGRKALEEVNDELGYEQPWEDKSCEYPDNLASPLKILVEASNGASDYGNKFGEPLICGYTRAFGMNDSNGTRYEWVKPIMF… |
| A0A090WR60 | 69-243 | None |
| A0A812X717 | 1-145 | None |
| W2PBM1 | 447-607 | None |
| A0A1A9UK57 | 95-254 | None |
| A0A1Q9DWZ8 | 121-257 | None |
| A0A509B6N8 | 11-158 | None |
| A0A2R7WF48 | 1-129 | None |
| A0A1I8IYT1 | 381-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.