DPCstruct | MC31613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 123 ± 24 aa |
| Standard deviation of domain lengths | 23.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 77.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3CF56 | 27-108 | YRALARALIHYATSSITPQQTQKEISVMAKILEKKSPCNFLIFGLGHDSLMWSSLNFGRRTVFLEEDEAWIDQIRRRFPMLE |
| A0A438FKJ2 | 3-110 | QTQTSTPAAEEQPPSRDCPSLPLTPTCTKTPPSLAQALVHYATLNITPQQTFNEISVSLRVLQKKAPCNFLVFGLGHDSLMWSALNH… |
| A0A6P0TLB4 | 26-183 | None |
| A0A438JDD0 | 1-125 | None |
| A0A3S3NI30 | 15-159 | None |
| A0A484M6V6 | 365-484 | None |
| A0A453ST72 | 134-290 | None |
| A0A0E0JVT0 | 272-405 | None |
| A0A2G3AZL7 | 431-552 | None |
| A0A835E3X3 | 22-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.