DPCstruct | MC31611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 117 ± 4 aa |
| Standard deviation of domain lengths | 3.88 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078G131 | 9-121 | TLEEKYIELCKKHGTVPNTSILFAFFEAEDKKSRNQRCTMNLLVDRVMYDDFHPLLELCNEINAFEVEGIDLSVRSSCSLEDQYVLS… |
| A0A438FBU8 | 2-121 | HLLTLNYCGFVARYLDSCKRHGVVPNSAVLSWFYKAKIQKSSHEKCSIVVLLDHLRAADFSPLIDVFLEIDSSNIDAVDILHESPII… |
| A0A7J0EU71 | 3-120 | None |
| A0A4D9C0T0 | 10-122 | None |
| A9SP45 | 252-374 | None |
| A0A7N0TXD5 | 1-123 | None |
| A0A5N5LYV2 | 83-202 | None |
| A0A314ZCS0 | 5-118 | None |
| A0A1S4B4B1 | 3-117 | None |
| V4S6R8 | 8-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.