DPCstruct | MC31610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834ST29 | 1-73 | MAERRFRIGYALAHKKQQSFIRDSLVSLAQSRGIDLVRVDRDRPLVDQAPFDCVLHKLYGDDWKAQLREFQLK |
| A0A0K9NGZ2 | 7-88 | EKEHYRQHQPPQPQQPKLVVGYALTSKKVESFLQPKLERLARKKGILFIAIDPNKPLSDQGPFNVVLHKLSGKEWCKVLESS |
| A0A7S0DEY2 | 1-85 | None |
| A0A6F9CH31 | 92-189 | None |
| A0A834SWH9 | 104-188 | None |
| A0A1R3GCK2 | 848-927 | None |
| A0A803MTH2 | 26-111 | None |
| A0A6P4N836 | 9-85 | None |
| A0A3Q7JXS0 | 8-83 | None |
| A0A445LXG9 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.