DPCstruct | MC3161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 8.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8AWE6 | 91-174 | TAQTGTHYANFDDNSIDRKEIKLAFSEALNLAPENIEEWWLDGPNSSDIYGFLSNKKTNEAYKVHLHWIDNTGWQPSLVEKLHT |
| W7DAZ9 | 1-89 | MIPTEQKGDHINSYEMDSQDWSEKVAAFSEATGIDKGDMTVWYVGRGENPATQSVGTISTKEDPDKAYRIYITWKDGSGWQPTKVEE… |
| A0A1X6PLB5 | 1-74 | None |
| A0A345BUC4 | 23-105 | None |
| A0A291KHM4 | 144-236 | None |
| A0A4Q4IGI7 | 115-201 | None |
| A0A0B0HRX1 | 54-129 | None |
| A0A2B5JM77 | 104-179 | None |
| A0A7Z8W2S4 | 156-231 | None |
| A0A061N8R8 | 1-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.