DPCstruct | MC31609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 65 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438F481 | 3-73 | TSEESDGDEGDTREENRRRRKEGSFGVESKTFKIGVEEKKGKTQVIIVESKGGVSSWVRLGPMSVEVFLAV |
| A0A438BVX4 | 1-50 | MKESSFTVESKMFEIVLDERRGKPQFLIMEKKRGVSSWVRLGSESLGFFM |
| A0A438EMP7 | 81-137 | None |
| A0A438ENN2 | 1-61 | None |
| A0A438EJ93 | 11-100 | None |
| A5B1V1 | 18-92 | None |
| A0A438I013 | 36-92 | None |
| A0A438I5D8 | 221-280 | None |
| A0A438IB87 | 10-69 | None |
| A0A438IBA9 | 36-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.