DPCstruct | MC31608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 2 aa |
| Standard deviation of domain lengths | 2.33 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 47.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8HR22 | 1-99 | MTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGGALFGIWYITYGHELIWKNREPLVKIWHEM… |
| A0A6P6NFZ4 | 262-355 | SGAIMTVLAAVCTKMPEAKLAIIFLPMYTFTAGNALKAIVALDTTGLILGWRFFDHAAHLGGALFGIWYIIYGHELVWKNREPLVKL… |
| A0A5E4B3N9 | 591-683 | None |
| A0A2I0TUU3 | 129-223 | None |
| A0A1S8VZN5 | 345-440 | None |
| A0A7S1KSA3 | 386-483 | None |
| A0A5E4MHI9 | 136-228 | None |
| A0A6G0V2D1 | 237-327 | None |
| A0A1B0DMJ2 | 596-690 | None |
| A0A016VFS6 | 340-432 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.