DPCstruct | MC31607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 175 ± 20 aa |
| Standard deviation of domain lengths | 20.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7U0R6 | 2-160 | YICSNESLPILYKLEGSVQKCPDNYTVAVGKYRNAQNETGWGILEVETFPNFPVEMQAYAAGLVEGLLTKVQIHYHYLNTVSQLCKN… |
| A0A7J8H5J9 | 38-198 | LASAIQTPGSRWGSEGPVPPASRSRSVLLDPQTGQLRLVDGRHPGAVAWANLTNAIHETGWAFLELHTNGHYSDGLQAYAAGVVEAA… |
| A0A7J8JL94 | 12-182 | None |
| A0A816VZ88 | 516-682 | None |
| A0A820MDS5 | 1-143 | None |
| A0A2J8AIU2 | 36-203 | None |
| D3B7Q9 | 26-203 | None |
| A0A0D8XQZ6 | 17-164 | None |
| A0A2A2K7D7 | 534-695 | None |
| A0A0R3TAL0 | 45-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.