DPCstruct | MC31603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 81 ± 3 aa |
| Standard deviation of domain lengths | 3.45 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8GFI8 | 1-80 | MTTANSPHNPQSTVDLGAQYITRTPHYAKKHQSFYDELLVHGILKPLTSPIEGMVMKEGDCNFVAPQGVSSIIKHYLKES |
| A0A423SB07 | 1-84 | MATSRSPHDKECTADLGAQYISATPEYAKLHTTYYEELINAGVLAPLTTKVVGMKVTDEGTKHYVTPSGVSSIVKHFMKEADID |
| A0A3L7HYR7 | 1-81 | None |
| H2ZSC4 | 12-93 | None |
| A0A3Q7T127 | 1-83 | None |
| A0A672FDR3 | 41-121 | None |
| A0A091DKG9 | 43-125 | None |
| A0A6P9CRM4 | 44-121 | None |
| A0A6P3HCE8 | 121-191 | None |
| A0A226MDU7 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.