DPCstruct | MC31601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 923 |
|---|---|
| Mean domain length (aa) | 152 ± 35 aa |
| Standard deviation of domain lengths | 35.32 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 70.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 27.03 |
| Pfam Score | 86.40 |
| Assigned Pfam label(s) | CL0111- CL0644- PF00057- CL0550- CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8KB35 | 27-200 | CDSSHFECDNGSCISQYDFCNGEKNCPDGSDETALTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVNECADGSDETRLRCGNEDDIR… |
| A0A1S3R509 | 15-168 | CDTLRDCPDGFDEESCITKCPNRGEFRCKDRRKCIERSLVCDGRSHCQDGSDEVGCQTIAAPTSQTLPLKCRMGSRLCKDGKECVLH… |
| A0A814V393 | 62-262 | None |
| A0A814SF90 | 453-616 | None |
| B7Z4R1 | 260-399 | None |
| A0A6I9K606 | 65-192 | None |
| A0A4Y2UTU5 | 20-163 | None |
| A0A7C7NAB7 | 153-286 | None |
| A0A7C7N9K0 | 480-581 | None |
| E9FR25 | 668-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.