DPCstruct | MC31600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 176 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835Z9F1 | 9-177 | KRKRARNTGNIPELTPDETEKKLVAMLDSQGGLAPNMVEAYLPLMVKAANVEKRALFLCVLRATTEPSCLARFVEAGGLQVLRLWIK… |
| A0A1S3R390 | 2-159 | AVGPVDPREVLKGVENFLGKDGELRSLEGVTKVFSFMKASHKMVSRCMYLNILLQTKSHDILNRFIRVGGYKLLNTWLTYSKTSTNT… |
| A0A662X6U7 | 105-268 | None |
| A0A397ER87 | 61-224 | None |
| A0A7S2RPH9 | 20-177 | None |
| A0A6P8BUD0 | 22-270 | None |
| A0A7N0U362 | 3-168 | None |
| A0A834TAH2 | 194-329 | None |
| A0A2H9TK25 | 559-735 | None |
| A0A3Q0KED8 | 7-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.