DPCstruct | MC3160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 392 ± 35 aa |
| Standard deviation of domain lengths | 35.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M9FNI9 | 17-352 | RNGSKVSMDLQAKLAQISGVLPVVQITDEDTTVSINTTSTSSGRNGGVIRFDSNESLIEVNNGASLKIEAPQTSALLYDTATNSRIL… |
| W7CVA1 | 1-402 | MKNVLKKPLTITLATLLLASQPGMASIAAFAAEAPAGGTQAIQGRSLAPVYVKTAAELKAAMINSSVKDIIFTADINWSGTINQKGS… |
| A0A842CI19 | 1-442 | None |
| W7C7J8 | 9-414 | None |
| A0A7X1CEQ9 | 21-399 | None |
| A0A384E0N5 | 1-368 | None |
| A0A4Y4G8G3 | 196-677 | None |
| A0A5A5U6Y2 | 30-375 | None |
| A0A5R8Q9Y0 | 3-368 | None |
| A0A223EFA5 | 20-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.