DPCstruct | MC316
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 166 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 17.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3E806 | 65-233 | EQEAELFLGLNDNRRVQPLYKFMAEVTAGHAESLDITRTVRDLGWIVSDSGAGNAIIAVAALRKIYGKSTEKGQLLRRTLRVVTDSW… |
| A0A1C5KJ52 | 5-180 | EDKKLSPYDLYKAGLAISDPVDTALKDLTEKYGVEIAATRSRNGVAKLQSITAAKDIICVEGIEALEWVFQLIHDTKWENEPSAYSS… |
| A0A0G1R892 | 86-245 | None |
| A0A6N6ZWF1 | 225-391 | None |
| A0A1G4PQ63 | 6-177 | None |
| C7H633 | 180-339 | None |
| A0A848VHX9 | 186-358 | None |
| A0A2U1X3L9 | 127-294 | None |
| A0A512JIT7 | 286-454 | None |
| A0A645HTR0 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.