DPCstruct | MC31598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 179 ± 32 aa |
| Standard deviation of domain lengths | 31.57 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085MQ81 | 2-148 | RIETLQKQVDLAQSMISSTSSNCTWDNERVVGFVSSSGENNWTEQEENLARWAFSKWKFYQFTSLRDDLWGNAIFLKEANAISVELK… |
| A0A1S3R1K4 | 2-155 | QNVVQVLEKQYLEEKRTALEEQRMMYERELESLRQQLSPERTNQHQRSSSDRLTFPTHTPSHHSKIRPWTEERDELFRQSLSRLKEQ… |
| A0A6J3BYT3 | 15-143 | None |
| A0A232FMM3 | 221-376 | None |
| A0A6J3H646 | 154-344 | None |
| A0A803XQP0 | 701-859 | None |
| A0A2I0TMF4 | 288-427 | None |
| A0A821HQ17 | 1-223 | None |
| A0A3M6WJD9 | 486-717 | None |
| A0A7J7ZX23 | 15-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.