DPCstruct | MC31597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.51 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0023- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498MF05 | 3-77 | SDAEMAQYGPAAVYLRKPEKERIEAQNRPFDAKTACFVPDAKELYIKGVIQKREGGKATVQTETGETVTVKDEEC |
| A0A1S3R069 | 1-93 | MSTDAEMQVYGKAAIYLRKSEKERMEAQAMPFDSKNACYVTDKVELYLKGLVTARADGKCTVTVTNPDGSKEEGKEFKDADIYEMNP… |
| Q7LZL1 | 4-74 | None |
| A0A498P2W9 | 166-245 | None |
| B9ELC0 | 1-76 | None |
| A0A4W5QWL1 | 1-87 | None |
| A0A7J5Y9V3 | 1-87 | None |
| A0A1V4JIZ9 | 376-453 | None |
| A0A498LMP6 | 215-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.