DPCstruct | MC31596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 83 ± 3 aa |
| Standard deviation of domain lengths | 3.20 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 71.67 |
| Assigned Pfam label(s) | PF20512- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3QXU4 | 7-84 | QFEGLCGFRPVEEIIGFLKSIPEFHALVGNEAAEELQSSIGEALRISLALKKCFTRMMNCEKKVFVDQLNMLVKRVTE |
| C4WSR3 | 133-212 | MAIALSNFEGLCGFRPYSEIRFFLEEIPEFKLIVGCDLIDQFKKDTTNSQYLLKDIFYKLMTSEKGIISQNLSSHKKKLQ |
| A0A1W0VWD5 | 152-238 | None |
| A0A4C1WBW4 | 37-121 | None |
| A0A453DSZ1 | 1-80 | None |
| A0A811PLT3 | 90-175 | None |
| A0A833RV65 | 200-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.