DPCstruct | MC31595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 2 aa |
| Standard deviation of domain lengths | 2.30 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 71.71 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF16172- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3I5P7 | 34-103 | SVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETLKVAIPIEDVNRSHLRFTFRHRSSQDSK |
| A0A1S3QTK5 | 1-72 | MTVYDEDGKKLENVMFPGAGDEGILEYKSVIYYQIKQPRWFETIKVAIPIEDVNRSHLRFTFRHRSSQECKY |
| A0A7J7F2M1 | 589-658 | None |
| A0A0S7ETW5 | 41-109 | None |
| A0A2R8QA05 | 1-72 | None |
| A0A6P6CQH5 | 147-216 | None |
| A0A674K5X6 | 317-382 | None |
| F6YR61 | 363-432 | None |
| F6T7L5 | 383-452 | None |
| A0A5E4D5P7 | 332-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.