DPCstruct | MC31592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 2 aa |
| Standard deviation of domain lengths | 1.98 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 92.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 67.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3QRD0 | 1-84 | LLYQDVFSVWEVIWVAPHISSQHFILFLALALVEVYREIIRDNTMDFTDIITFFNEMAERHDVQHILQVARELVRKVQSLIENK |
| A0A3P6RVR2 | 60-149 | LLDFKRELTYQQVFRVWEVIWSSSRMITQHFQLFFALALLTTYRHIIIDNRMDFTDVIKFFNEMAERHDVDTLLDSARTLLERLQAL… |
| A0A814AXR8 | 549-632 | None |
| A0A6G0I0U7 | 314-398 | None |
| A0A6G0YN22 | 184-268 | None |
| A0A087Y1N1 | 1010-1094 | None |
| A0A4W4FK04 | 864-948 | None |
| A0A6A0GU14 | 443-527 | None |
| A0A1I7VVA0 | 190-270 | None |
| R7VHV1 | 412-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.