DPCstruct | MC31591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 283 ± 55 aa |
| Standard deviation of domain lengths | 54.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 33.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14694 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5X8D3 | 15-313 | RLACLTEAYTCLRRGSCPSQRAHDVASAIFVGVCGGVSSEDRESCPPENHSDPTVELSCISMSLLEKISSALMSGSLPPAATLYHTE… |
| A0A411AHG1 | 1-307 | MKVFCEVLEELYKKVLLGATLENDSHDYIFYLNPAVSDQDCSTATSLEWANTCGIQGRHQPISVGVAPIAVAPVCLKTNSQMSGSRE… |
| A0A401SQ86 | 58-314 | None |
| A0A3Q3ANT2 | 2-243 | None |
| A0A670J6K6 | 1-386 | None |
| L5JUX1 | 81-307 | None |
| A0A2J8VXR5 | 49-303 | None |
| Q8BRI6 | 9-278 | None |
| A0A3B3D939 | 74-274 | None |
| A0A1S3QQT1 | 45-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.