DPCstruct | MC3159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 178 ± 30 aa |
| Standard deviation of domain lengths | 29.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K8XAH6 | 38-230 | TLKKTVKIELVPLIELPTFKFPDLNDITDIDEKNRLLIERNYSGVKNLKPFNEHQYKLSDISDSDLKKAIELHVSDIPIAESCAFFG… |
| A0A089YQZ9 | 1-157 | MPLQQQTHGPCPTDPLGAFLHGLLTMPDLFAAGGFRVADTATDTVFIEPGCCNGLETWQDWLEVLDGTGCSYFGHDPSSAAERVGDT… |
| A0A354P365 | 27-178 | None |
| A0A2T0N1B4 | 457-616 | None |
| A0A3G6MDA5 | 10-224 | None |
| A0A544YA25 | 7-228 | None |
| G8S5R1 | 1-190 | None |
| A0A855HQ20 | 1-139 | None |
| E9UX87 | 1-212 | None |
| A0A3A8EZA2 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.