DPCstruct | MC31589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0020- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P6RX41 | 68-170 | DGHMDDCYTFFMALEEESKSARVIRKCSSVLNRFLKGIDALQNEGQQAQDWARVDLNEVLKLMEDLIEYFSQPEDEQDFEEKQNRLR… |
| A0A0C2CLV8 | 656-757 | GHMDDCYTFFMALEEESKSARVIRKCSSVLNRFLKGIDALQNEGHHSADWARVDLNEVLKLMEDLIEYFSQPSDEQDFEEKQTRFRA… |
| A0A183WPA2 | 142-252 | None |
| A0A821WAM9 | 3-102 | None |
| A0A0M3J0C2 | 68-165 | None |
| A0A6J1WBS5 | 1-102 | None |
| A0A2G8JD16 | 111-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.