DPCstruct | MC31582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 342 ± 58 aa |
| Standard deviation of domain lengths | 58.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0220- PF18292- CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7FGG9 | 25-340 | GANFHEKILSSLNVTELNVTTLNVLLTKLKLQNCSTGNTNQLDVGQRCVPAEYLFETHKLDKSKKVSPRELAELSTSLLYVLLPENV… |
| A0A1S3QL01 | 34-383 | TVYRYFPVILLCLSFHLFSYAWCSPMDVYGKVVELVSPGEEYLDEMSVRSFFKLLEKRVQCPGVSCEKCLSVQSVDQLVGNFTSTGG… |
| A0A7J8EAM8 | 18-357 | None |
| A0A3L7I1F4 | 7-362 | None |
| H2ZUM9 | 2-293 | None |
| F7D971 | 33-361 | None |
| A0A6J2DQM4 | 22-322 | None |
| M0RAL0 | 1-243 | None |
| A0A2G8JQL8 | 17-483 | None |
| A0A7M7PFG3 | 10-433 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.