DPCstruct | MC31581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 155 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.28 |
| Pfam Score | 83.60 |
| Assigned Pfam label(s) | CL0229- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8T2T0 | 325-484 | GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGIYGLLKRRDDWPSRLQLFFANNHDQEFDPPKLYPPIAAEKRKPIRV… |
| A0A1S3QJ26 | 1-163 | CFCVECVDLLVGLGSASAAIREDPWNCYMCETHNTHGLLRRRDDWPSRLQVFFANNHEQEFEAARLYPPVAAERRQPIRVLSLFDGI… |
| A0A834XMX8 | 468-635 | None |
| A0A3B4HCP0 | 617-785 | None |
| A0A834JKS4 | 722-892 | None |
| A0A6J2A7V8 | 408-550 | None |
| A0A401RZ46 | 47-197 | None |
| A0A1I8IPI0 | 142-305 | None |
| A0A6P9A0T4 | 85-234 | None |
| A0A672YNH7 | 338-480 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.