DPCstruct | MC3158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 10 aa |
| Standard deviation of domain lengths | 10.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19979 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4NQC3 | 2-112 | RTETPDIETMRDSVTRALVDMPALPAPDAEALDTLAATLRGHVVVLVPEVEALAAQRPEGDVPGRVALACVEEARRKLRVRDGHTVQ… |
| A0A089XMS5 | 1-127 | MRQATTPAPESGSAVLWPLDVTMMRTSARHLLAEDAELPSDEALDTLVLQLRGHVMLAIPFVEALAARLPEGDLPRACALAGISEAR… |
| A0A5C8Q0U6 | 3-106 | None |
| A0A2G6ZCD5 | 35-159 | None |
| A0A6B2XI80 | 2-131 | None |
| A0A2S1T1L0 | 5-135 | None |
| A0A2N3VXC7 | 149-270 | None |
| A0A1I4VDW2 | 4-124 | None |
| A0A7H8LGR1 | 1-105 | None |
| A0A1D8G0Q1 | 78-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.