DPCstruct | MC31578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 249 ± 28 aa |
| Standard deviation of domain lengths | 28.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0630- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9P0M6 | 84-302 | LFFGGNTHNDTSLSNGAKCFSADFLAYDIACDEWRVLPKPDLHRDVNRFGHSAVVSNGSMFVFGGFSGMLLNDVLVYRPPSCQAFLA… |
| A0A6P7V9F7 | 492-721 | LVFGGNTHNDTAFSTGDKCFSADLLAYDLECDSWQTLPGPSSMQLERFGHSAVVYNQSLYIFGGFNGQMLASLVRYTPGACRGLSTA… |
| A0A0A9YIC6 | 207-476 | None |
| A0A177BCL8 | 272-543 | None |
| A0A1Y3BLI1 | 135-439 | None |
| A0A1A8QWD6 | 239-465 | None |
| A0A2H8TLB5 | 24-270 | None |
| A0A183IZP0 | 394-617 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.