DPCstruct | MC31574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 214 ± 22 aa |
| Standard deviation of domain lengths | 21.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2NJC4 | 3-211 | MDSEPDVSMEEVTGNRSFPAGKKGKVPRRKAEREKLKREQLNELFLELASALELSQTNTGKASILCETTRLLKDLLTQIESLKKDNV… |
| A0A438HCJ8 | 48-218 | EFKDFVIARKVQKADREKLKRDRLNEQFIELRNALDPDRPKNDKATILSYTIQLVKDLTAQVEKLKAENASLNEESRELTQEKNDLR… |
| A0A7I8KCR1 | 1-201 | None |
| A0A0H3YC44 | 8-205 | None |
| A0A5B6Z8Q9 | 3-183 | None |
| A0A2R6XB55 | 2-228 | None |
| A0A540MFF2 | 2-192 | None |
| A0A843U9T1 | 118-325 | None |
| A0A1U8A9Z9 | 1-219 | None |
| A0A7J7MIH3 | 21-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.