DPCstruct | MC31573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 40.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2NIJ6 | 1-81 | MGNEVAGLQLPVPVHQSDELPCYCIFAGLGFVPITRPYLRDYGEEWCNTSPCRVCEQALKELPEKAGQQLIILSQVKKVNG |
| A0A7R9Z3Q2 | 286-376 | LRLQAPVRLVPFHTRGLPPSYFIIAGLVFTPVTVPYLKSEYGKDYDYDAPVRLLEKMMHSMADEPNQQVVVLSQVLAADINIGYEEI… |
| A0A6N2NF01 | 1-99 | None |
| A0A0D2MLE6 | 86-158 | None |
| A0A0S4KGQ2 | 59-178 | None |
| A0A2P2MQ27 | 1-93 | None |
| A0A813QF04 | 435-521 | None |
| A0A7S3ZGQ1 | 39-122 | None |
| A0A445MH45 | 61-137 | None |
| R1DWZ2 | 396-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.