DPCstruct | MC31571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MDD9 | 1-61 | MQRVLIVGAGQGGSALLETLLKTNMIQIIAIADLDLEAPGMVEAKKNGIDTTTDWKEYIKR |
| A0A1W9U0D0 | 1-71 | MREILQNSNIVIVGGGKVCRAVLAIILGKNFINHKLSILGVADINDKAEGLVYAKERGIFTTTDYKDLFFR |
| A0A353H6B7 | 17-77 | None |
| A0A1G3C2M9 | 1-57 | None |
| A0A318CMU9 | 1-70 | None |
| A0A7C6VY87 | 1-61 | None |
| A0A3N0ZM98 | 1-76 | None |
| A0A496Z5D5 | 6-71 | None |
| A0A3D2PAT8 | 6-68 | None |
| F7Z5D4 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.