DPCstruct | MC3157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562WT30 | 4-67 | CTPYHAGWGKPLPAGHGLGIAVHESFGSFVAQVAEVSVPVKGAIRVHLMVCAIDCGRIVDPDRI |
| A0A160VH46 | 280-345 | KLAAKKASWGESTPTGRYKGLSCHESFGSYVAQVAEVSIGEDNIVTVHRVVCVIDCGQTVNPSIVE |
| A0A4D4N7P9 | 529-597 | None |
| A0A1F4N2A9 | 94-176 | None |
| A0A1S1T4L8 | 1-55 | None |
| A0A843S4B1 | 109-173 | None |
| A0A534WFM1 | 37-119 | None |
| A0A812TG10 | 259-318 | None |
| A0A1G7UD69 | 180-243 | None |
| A0A3R7SX78 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.